TA344525 Vacuolar-sorting protein SNF8 antibody

Rabbit Polyclonal Anti-SNF8 Antibody - middle region

See related secondary antibodies

Search for all "Vacuolar-sorting protein SNF8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat Vacuolar-sorting protein SNF8

Product Description for Vacuolar-sorting protein SNF8

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat Vacuolar-sorting protein SNF8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Vacuolar-sorting protein SNF8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EAP30, ELL-associated protein of 30 kDa, ESCRT-II complex subunit VPS22
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96H20
Immunogen:
The immunogen for anti-SNF8 antibody: synthetic peptide directed towards the middle region of human SNF8. Synthetic peptide located within the following region: DHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQA.
GeneID:
11267
Application WB
Background ELL encodes an R polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of R polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitited membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with R polymerase II elongation factor.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Vacuolar-sorting protein SNF8 (7 products)

Catalog No. Species Pres. Purity   Source  

Vacuolar-sorting protein SNF8

Vacuolar-sorting protein SNF8 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Vacuolar-sorting protein SNF8 (1-258, His-tag)

Vacuolar-sorting protein SNF8 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

Vacuolar-sorting protein SNF8 (1-258, His-tag)

Vacuolar-sorting protein SNF8 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

Vacuolar-sorting protein SNF8

Vacuolar-sorting protein SNF8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Vacuolar-sorting protein SNF8

Vacuolar-sorting protein SNF8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Vacuolar-sorting protein SNF8

Vacuolar-sorting protein SNF8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Vacuolar-sorting protein SNF8

Vacuolar-sorting protein SNF8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Vacuolar-sorting protein SNF8 (3 products)

Catalog No. Species Pres. Purity   Source  

SNF8 293T Cell Transient Overexpression Lysate(Denatured)

SNF8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SNF8 Lysate

Western Blot: SNF8 Lysate [NBL1-16280] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SNF8
  Novus Biologicals Inc.

SNF8 overexpression lysate

SNF8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn