TA344581 RNF216 antibody

Rabbit Polyclonal Anti-RNF216 Antibody - N-terminal region

See related secondary antibodies

Search for all "RNF216"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RNF216

Product Description for RNF216

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat RNF216.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF216

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase RNF216, RING finger protein 216, TRIAD3, Triad domain-containing protein 3, UBCE7IP1, Ubiquitin-conjugating enzyme 7-interacting protein 1, ZIN, Zinc finger protein inhibiting NF-kappa-B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NWF9
Immunogen:
The immunogen for Anti-Rnf216 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Rnf216. Synthetic peptide located within the following region: IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS.
GeneID:
54476
Application WB
Background Rnf216 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. It promotes degradation of TRAF3, TLR4 and TLR9. It contributes to the regulation of antiviral responses. It down-regulates activation of NF-kappa-B, IRF3 activation and IFNB production and promotes TNF and RIP mediated apoptosis.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF216 (1 products)

Catalog No. Species Pres. Purity   Source  

RNF216

RNF216 Human
  Abnova Taiwan Corp.

Positive controls for RNF216 (1 products)

Catalog No. Species Pres. Purity   Source  

TRIAD3 Lysate

Western Blot: TRIAD3 Lysate [NBL1-15444] - Western Blot experiments. 
Left - Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for RNF216
  Novus Biologicals Inc.
  • LinkedIn