TA344599 Glutaredoxin-2 / GLRX2 antibody

Rabbit Polyclonal Anti-GLRX2 Antibody - middle region

See related secondary antibodies

Search for all "Glutaredoxin-2 / GLRX2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit Glutaredoxin-2 / GLRX2

Product Description for Glutaredoxin-2 / GLRX2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit Glutaredoxin-2 / GLRX2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Glutaredoxin-2 / GLRX2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GRX2, Glutaredoxin-2 mitochondrial, grxB
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NS18
Immunogen:
The immunogen for anti-GLRX2 antibody: synthetic peptide directed towards the middle region of human GLRX2. Synthetic peptide located within the following region: NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH.
GeneID:
51022
Application WB
Background GLRX2 is a glutathione-dependent oxidoreductase that facilitates the maintence of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress.GLRX2 is involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress.GLRX2 acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides.GLRX2 can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions.GLRX2 efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression of GLRX2 decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Glutaredoxin-2 / GLRX2 (7 products)

Catalog No. Species Pres. Purity   Source  

Glutaredoxin-2 / GLRX2 (transcript variant 1)

Glutaredoxin-2 / GLRX2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Glutaredoxin-2 / GLRX2 (20-164, His-tag)

Glutaredoxin-2 / GLRX2 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €720.00
  OriGene Technologies GmbH

Glutaredoxin-2 / GLRX2 (20-164, His-tag)

Glutaredoxin-2 / GLRX2 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €290.00
  OriGene Technologies GmbH

Glutaredoxin-2 / GLRX2

Glutaredoxin-2 / GLRX2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Glutaredoxin-2 / GLRX2

Glutaredoxin-2 / GLRX2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Glutaredoxin-2 / GLRX2

Glutaredoxin-2 / GLRX2 Human
  Abnova Taiwan Corp.

Glutaredoxin-2 / GLRX2

SDS-Page: Glutaredoxin 2 Protein [NBP1-30299] - Glutaredoxin-2, 17.0 kDa (154aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE
  Novus Biologicals Inc.

Positive controls for Glutaredoxin-2 / GLRX2 (3 products)

Catalog No. Species Pres. Purity   Source  

GLRX2 293T Cell Transient Overexpression Lysate(Denatured)

GLRX2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GLRX2 293T Cell Transient Overexpression Lysate(Denatured)

GLRX2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GLRX2 overexpression lysate

GLRX2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn