TA344609 SCYL3 / PACE1 antibody

Rabbit Polyclonal Anti-SCYL3 Antibody - N-terminal region

See related secondary antibodies

Search for all "SCYL3 / PACE1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat SCYL3 / PACE1

Product Description for SCYL3 / PACE1

Rabbit anti Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat SCYL3 / PACE1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SCYL3 / PACE1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ezrin-binding protein PACE-1, Protein-associating with the carboxyl-terminal domain of ezrin, SCY1-like protein 3
Presentation Purified
Reactivity Bov, Can, Eq, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IZE3
Immunogen:
The immunogen for anti-SCYL3 antibody: synthetic peptide directed towards the N terminal of human SCYL3. Synthetic peptide located within the following region: MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV.
GeneID:
57147
Application WB
Background SCYL3 may play a role in regulating cell adhesion/migration complexes in migrating cells.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SCYL3 / PACE1 (5 products)

Catalog No. Species Pres. Purity   Source  

SCYL3 / PACE1 (transcript variant 1)

SCYL3 / PACE1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SCYL3 / PACE1

SCYL3 / PACE1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SCYL3 / PACE1

SCYL3 / PACE1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SCYL3 / PACE1

SCYL3 / PACE1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SCYL3 / PACE1

SCYL3 / PACE1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SCYL3 / PACE1 (3 products)

Catalog No. Species Pres. Purity   Source  

SCY1 like 3 Lysate

Western Blot: SCY1 like 3 Lysate [NBL1-15757] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SCYL3
  Novus Biologicals Inc.

SCYL3 293T Cell Transient Overexpression Lysate(Denatured)

SCYL3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SCYL3 overexpression lysate

SCYL3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn