TA344615 Protein phosphatase 1B / PPM1B antibody

Rabbit Polyclonal Anti-PPM1B Antibody - N-terminal region

See related secondary antibodies

Search for all "Protein phosphatase 1B / PPM1B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Protein phosphatase 1B / PPM1B

Product Description for Protein phosphatase 1B / PPM1B

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Protein phosphatase 1B / PPM1B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Protein phosphatase 1B / PPM1B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PP2C-beta, PP2CB, Protein phosphatase 2C isoform beta
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75688
Immunogen:
The immunogen for anti-PPM1B antibody: synthetic peptide directed towards the N terminal of human PPM1B. Synthetic peptide located within the following region: EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN.
GeneID:
5495
Application WB
Background The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Protein phosphatase 1B / PPM1B (6 products)

Catalog No. Species Pres. Purity   Source  

Protein phosphatase 1B / PPM1B (transcript variant 3)

Protein phosphatase 1B / PPM1B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Protein phosphatase 1B / PPM1B (transcript variant 1)

Protein phosphatase 1B / PPM1B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Protein phosphatase 1B / PPM1B (transcript variant 2)

Protein phosphatase 1B / PPM1B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Protein phosphatase 1B / PPM1B

Protein phosphatase 1B / PPM1B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Protein phosphatase 1B / PPM1B

Protein phosphatase 1B / PPM1B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Protein phosphatase 1B / PPM1B

Protein phosphatase 1B / PPM1B Human
  Abnova Taiwan Corp.

Positive controls for Protein phosphatase 1B / PPM1B (4 products)

Catalog No. Species Pres. Purity   Source  

PPM1B 293T Cell Transient Overexpression Lysate(Denatured)

PPM1B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PPM1B Lysate

Western Blot: PPM1B Lysate [NBL1-14659] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPM1B
  Novus Biologicals Inc.

PPM1B overexpression lysate

PPM1B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PPM1B overexpression lysate

PPM1B overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn