TA344618 P4HTM / PH4 antibody

Rabbit Polyclonal Anti-PH-4 Antibody - middle region

See related secondary antibodies

Search for all "P4HTM / PH4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat P4HTM / PH4

Product Description for P4HTM / PH4

Rabbit anti Bovine, Canine, Human, Mouse, Rat P4HTM / PH4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for P4HTM / PH4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HIF-PH4, HIF-prolyl hydroxylase PH-4, HPH-4, Hypoxia-inducible factor prolyl 4-hydroxylase, Transmembrane prolyl 4-hydroxylase
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NXG6
Immunogen:
The immunogen for anti-PH-4 antibody: synthetic peptide directed towards the middle region of human PH-4. Synthetic peptide located within the following region: RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH.
GeneID:
54681
Application WB
Background The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. It plays a role in adaptation to hypoxia and m
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for P4HTM / PH4 (2 products)

Catalog No. Species Pres. Purity   Source  

P4HTM / PH4

P4HTM / PH4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

P4HTM / PH4

P4HTM / PH4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for P4HTM / PH4 (3 products)

Catalog No. Species Pres. Purity   Source  

HIF Prolyl Hydroxylase 4 Lysate

Western Blot: HIF Prolyl Hydroxylase 4 Lysate [NBL1-14344] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for P4HTM
  Novus Biologicals Inc.

P4HTM overexpression lysate

P4HTM overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

PH-4 293T Cell Transient Overexpression Lysate(Denatured)

PH-4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn