TA344620 Acid ceramidase antibody

Rabbit Polyclonal Anti-ASAH1 Antibody - N-terminal region

See related secondary antibodies

Search for all "Acid ceramidase"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat Acid ceramidase

Product Description for Acid ceramidase

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat Acid ceramidase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Acid ceramidase

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ASAH, ASAH1, Acylsphingosine deacylase, N-acylsphingosine amidohydrolase, PHP32, Putative 32 kDa heart protein
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13510
Immunogen:
The immunogen for anti-ASAH1 antibody: synthetic peptide directed towards the N terminal of human ASAH1. Synthetic peptide located within the following region: MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY.
GeneID:
427
Application WB
Background This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslatiolly. The encoded protein catalyzes the synthesis and degradation of ceramide into
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Acid ceramidase (6 products)

Catalog No. Species Pres. Purity   Source  

Acid ceramidase (transcript variant 2)

Acid ceramidase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Acid ceramidase

Acid ceramidase Human Purified
  Abnova Taiwan Corp.

Acid ceramidase

Acid ceramidase Human
  Abnova Taiwan Corp.

Acid ceramidase

Acid ceramidase Human Purified
  Abnova Taiwan Corp.

Acid ceramidase

Acid ceramidase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Acid ceramidase

Acid ceramidase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Acid ceramidase (2 products)

Catalog No. Species Pres. Purity   Source  

Acid ceramidase Lysate (Non-Denatured)

Acid ceramidase Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-ASAH1 antibody (H00000427-M01 ) by Western Blots.
  Abnova Taiwan Corp.

ASAH1 Lysate

Western Blot: ASAH1 Lysate [NBL1-07747] - Western Blot experiments.  Left - Empty vector transfected control cell lysate (HEK293 cell lysate); Right - Over-expression Lysate for ASAH1. Protein
  Novus Biologicals Inc.
  • LinkedIn