TA344625 PYCR1 antibody

Rabbit Polyclonal Anti-PYCR1 Antibody - middle region

See related secondary antibodies

Search for all "PYCR1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rabbit, Rat, Zebrafish PYCR1

TA344625

More Views

  • TA344625

Product Description for PYCR1

Rabbit anti Canine, Human, Mouse, Rabbit, Rat, Zebrafish PYCR1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PYCR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms P5C reductase 1, P5CR 1, Pyrroline-5-carboxylate reductase 1 mitochondrial
Presentation Purified
Reactivity Can, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P32322
Immunogen:
The immunogen for anti-PYCR1 antibody: synthetic peptide directed towards the middle region of human PYCR1. Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR.
GeneID:
5831
Application WB
Background This gene encodes an enzyme that catalyzes the D(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of DP(+) in some cell types. The protein forms a homopolymer and localizes
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PYCR1 (8 products)

Catalog No. Species Pres. Purity   Source  

PYCR1 (transcript variant 1)

PYCR1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PYCR1 (transcript variant 2)

PYCR1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PYCR1 (1-319, His-tag)

Recombinant human PYCR1, 1-319aa, His-tagged Human Purified > 90 % E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

PYCR1 (1-319, His-tag)

Recombinant human PYCR1, 1-319aa, His-tagged Human Purified > 90 % E. coli
50 µg / €400.00
  OriGene Technologies GmbH

PYCR1

PYCR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PYCR1

PYCR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PYCR1

PYCR1 Human Purified
  Novus Biologicals Inc.

PYCR1

PYCR1 Human Purified
  Novus Biologicals Inc.

Positive controls for PYCR1 (1 products)

Catalog No. Species Pres. Purity   Source  

PYCR1 293T Cell Transient Overexpression Lysate(Denatured)

PYCR1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn