TA344630 KLK7 / Kallikrein-7 antibody

Rabbit Polyclonal Anti-KLK7 Antibody - middle region

See related secondary antibodies

Search for all "KLK7 / Kallikrein-7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KLK7 / Kallikrein-7

Product Description for KLK7 / Kallikrein-7

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KLK7 / Kallikrein-7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KLK7 / Kallikrein-7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PRSS6, SCCE, Serine protease 6, Stratum corneum chymotryptic enzyme, hK7
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49862
Immunogen:
The immunogen for Anti-KLK7 antibody is: synthetic peptide directed towards the middle region of Human KLK7. Synthetic peptide located within the following region: IKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGT.
GeneID:
5650
Application WB
Background This gene encodes a member of the kallikrein subfamily of serine proteases. These enzymes have diverse physiological functions and many kallikrein genes are biomarkers for cancer. The encoded protein has chymotrypsin-like activity and plays a role in the proteolysis of intercellular cohesive structures that precedes desquamation, the shedding of the outermost layer of the epidermis. The encoded protein may play a role in cancer invasion and metastasis, and increased expression of this gene is associated with unfavorable prognosis and progression of several types of cancer. Polymorphisms in this gene may play a role in the development of atopic dermatitis.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KLK7 / Kallikrein-7 (9 products)

Catalog No. Species Pres. Purity   Source  

KLK7 / Kallikrein-7 (transcript variant 1)

KLK7 / Kallikrein-7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KLK7 / Kallikrein-7 (transcript variant 1)

KLK7 / Kallikrein-7 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

KLK7 / Kallikrein-7 (30-253, His-tag)

KLK7 / Kallikrein-7 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

KLK7 / Kallikrein-7 (30-253, His-tag)

KLK7 / Kallikrein-7 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

KLK7 / Kallikrein-7

KLK7 / Kallikrein-7 Human
  Abnova Taiwan Corp.

KLK7 / Kallikrein-7

KLK7 / Kallikrein-7 Human Purified
  Abnova Taiwan Corp.

KLK7 / Kallikrein-7

KLK7 / Kallikrein-7 Human Purified
  Abnova Taiwan Corp.

KLK7 / Kallikrein-7

KLK7 / Kallikrein-7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KLK7 / Kallikrein-7

KLK7 / Kallikrein-7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KLK7 / Kallikrein-7 (2 products)

Catalog No. Species Pres. Purity   Source  

Kallikrein-7 / KLK7 Lysate(Denatured)

Kallikrein-7 / KLK7 Lysate(Denatured)
  Abnova Taiwan Corp.

Kallikrein-7 / KLK7 Lysate(Denatured)

Kallikrein-7 / KLK7 Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn