TA344637 RAD51L1 antibody

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

See related secondary antibodies

Search for all "RAD51L1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse RAD51L1

TA344637

More Views

  • TA344637
  • TA344637

Product Description for RAD51L1

Rabbit anti Human, Mouse RAD51L1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAD51L1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA repair protein RAD51 homolog 2, R51H2, RAD51 homolog B, RAD51-like protein 1, RAD51B, REC2
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15315-1
Immunogen:
The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI.
GeneID:
5890
Application WB
Background The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutiorily conserved proteins essential for D repair by homologous recombition. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing D damage. At least three altertively spliced transcript variants encoding distinct isoforms have been observed.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn