TA344640 VPS16 antibody

Rabbit Polyclonal Anti-VPS16 Antibody - N-terminal region

See related secondary antibodies

Search for all "VPS16"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat VPS16

Product Description for VPS16

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat VPS16.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for VPS16

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Vacuolar protein sorting-associated protein 16 homolog
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H269
Immunogen:
The immunogen for anti-VPS16 antibody: synthetic peptide directed towards the N terminal of human VPS16. Synthetic peptide located within the following region: RGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRA.
GeneID:
64601
Application WB
Background Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps16 protein. The mammalian class C Vps proteins are predomintly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Two transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for VPS16 (5 products)

Catalog No. Species Pres. Purity   Source  

VPS16

VPS16 Human Purified
  Abnova Taiwan Corp.

VPS16

VPS16 Human
  Abnova Taiwan Corp.

VPS16

VPS16 Human Purified
  Abnova Taiwan Corp.

VPS16

VPS16 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

VPS16

VPS16 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for VPS16 (2 products)

Catalog No. Species Pres. Purity   Source  

VPS16 293T Cell Transient Overexpression Lysate(Denatured)

VPS16 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

VPS16 overexpression lysate

VPS16 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn