TA344642 MRPS33 antibody

Rabbit Polyclonal Anti-MRPS33 Antibody - middle region

See related secondary antibodies

Search for all "MRPS33"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat MRPS33

Product Description for MRPS33

Rabbit anti Canine, Human, Mouse, Rat MRPS33.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MRPS33

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 28S ribosomal protein S33, CGI-139, PTD003, S33mt, mitochondrial
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y291
Immunogen:
The immunogen for anti-Mrps33 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DWYPNHNTYFALMGNLRFLGLYRDEHQDFKDEQRRLKKLRGKGKPRKGEG.
GeneID:
51650
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MRPS33 (4 products)

Catalog No. Species Pres. Purity   Source  

MRPS33 (transcript variant 2)

MRPS33 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MRPS33 (full length, N-term HIS tag, transcript variant 1)

MRPS33 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

MRPS33

MRPS33 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MRPS33

MRPS33 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MRPS33 (1 products)

Catalog No. Species Pres. Purity   Source  

MRPS33 Lysate

Western Blot: MRPS33 Lysate [NBL1-13302] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MRPS33
  Novus Biologicals Inc.
  • LinkedIn