TA344651 SMEK1 antibody

Rabbit Polyclonal Anti-SMEK1 Antibody - middle region

See related secondary antibodies

Search for all "SMEK1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Zebrafish SMEK1

Product Description for SMEK1

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Zebrafish SMEK1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SMEK1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA2010, PP4R3A, PPP4R3A, SMEK homolog 1, SMEK1, Serine/threonine-protein phosphatase 4 regulatory subunit 3A
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IN85-2
Immunogen:
The immunogen for anti-SMEK1 antibody: synthetic peptide directed towards the middle region of human SMEK1. Synthetic peptide located within the following region: YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR.
GeneID:
55671
Application WB
Background SMEK1 is the regulatory subunit of serine/threonine-protein phosphatase 4.SMEK1 may regulate the activity of PPP4C at centrosomal microtubule organizing centers. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during D replication and required for D DSB repair.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn