TA344662 Matrilin-2 antibody

Rabbit Polyclonal Anti-MATN2 Antibody - middle region

See related secondary antibodies

Search for all "Matrilin-2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit Matrilin-2

Product Description for Matrilin-2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit Matrilin-2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Matrilin-2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MATN2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00339
Immunogen:
The immunogen for anti-MATN2 antibody: synthetic peptide directed towards the middle region of human MATN2. Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED.
GeneID:
4147
Application WB
Background MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Matrilin-2 (6 products)

Catalog No. Species Pres. Purity   Source  

Matrilin-2 (transcript variant 1)

Matrilin-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Matrilin-2

Matrilin-2 Human Purified
  Abnova Taiwan Corp.

Matrilin-2

Matrilin-2 Human
  Abnova Taiwan Corp.

Matrilin-2

Matrilin-2 Human Purified
  Abnova Taiwan Corp.

Matrilin-2

Matrilin-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Matrilin-2

Matrilin-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Matrilin-2 (2 products)

Catalog No. Species Pres. Purity   Source  

MATN2 293T Cell Transient Overexpression Lysate(Denatured)

MATN2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Matrilin 2 Lysate

Western Blot: Matrilin 2 Lysate [NBL1-12915] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MATN2
  Novus Biologicals Inc.
  • LinkedIn