TA344667 pro-Natriuretic Peptide C antibody

Rabbit Polyclonal Anti-NPPC Antibody - C-terminal region

See related secondary antibodies

Search for all "pro-Natriuretic Peptide C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse pro-Natriuretic Peptide C

Product Description for pro-Natriuretic Peptide C

Rabbit anti Human, Mouse pro-Natriuretic Peptide C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for pro-Natriuretic Peptide C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CNP2, NPPC
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P23582
Immunogen:
The immunogen for Anti-Nppc antibody is: synthetic peptide directed towards the C-terminal region of Nppc. Synthetic peptide located within the following region: LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS.
GeneID:
4880
Application WB
Background This gene encodes a member of the triuretic peptide family. triuretic peptides are involved in the control of blood pressure, extracellular fluid volume and electrolyte homeostasis. The encoded protein also plays a role in sensory neuron bifurcation, and is a critical regulator of endochondral bone growth. The encoded protein is a ligand for the triuretic peptide receptor B, and is synthesized as a preprohormone which is cleaved to produce a mature peptide. Mutations in this gene are associated with dwarfism resulting from impaired endochondral ossification.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for pro-Natriuretic Peptide C (2 products)

Catalog No. Species Pres. Purity   Source  

pro-Natriuretic Peptide C (24-126, His-tag)

pro-Natriuretic Peptide C Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

pro-Natriuretic Peptide C (24-126, His-tag)

pro-Natriuretic Peptide C Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH
  • LinkedIn