TA344669 IPPK antibody

Rabbit Polyclonal Anti-Ippk Antibody - C-terminal region

See related secondary antibodies

Search for all "IPPK"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat IPPK

Product Description for IPPK

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat IPPK.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IPPK

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3, 4, 5, 6)P5 2-kinase, 6-pentakisphosphate 2-kinase, C9orf12, IPK1 homolog, Inositol-1, Inositol-pentakisphosphate 2-kinase, Ins(1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H8X2
Immunogen:
The immunogen for anti-Ippk antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VFYQKLLDLSTEDDGTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQGTS.
GeneID:
64768
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IPPK (5 products)

Catalog No. Species Pres. Purity   Source  

IPPK

IPPK Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

IPPK

IPPK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IPPK

IPPK Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IPPK

IPPK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IPPK

IPPK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for IPPK (3 products)

Catalog No. Species Pres. Purity   Source  

IPPK 293T Cell Transient Overexpression Lysate(Denatured)

IPPK 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IPPK Lysate

Western Blot: IPPK Lysate [NBL1-12018] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IPPK
  Novus Biologicals Inc.

IPPK overexpression lysate

IPPK overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn