TA344676 POLR1E antibody

Rabbit Polyclonal Anti-POLR1E Antibody - N-terminal region

See related secondary antibodies

Search for all "POLR1E"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat POLR1E

TA344676

More Views

  • TA344676

Product Description for POLR1E

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat POLR1E.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POLR1E

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA-directed RNA polymerase I subunit E, DNA-directed RNA polymerase I subunit RPA49, PAF53, PRAF1, RNA polymerase I subunit A49, RNA polymerase I-associated factor 1, RNA polymerase I-associated factor 53
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZS1
Immunogen:
The immunogen for anti-POLR1E antibody: synthetic peptide directed towards the N terminal of human POLR1E. Synthetic peptide located within the following region: SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL.
GeneID:
64425
Application WB
Background POLR1E is a D-dependent R polymerase catalyzes the transcription of D into R using the four ribonucleoside triphosphates as substrates.POLR1E is the component of R polymerase I which synthesizes ribosomal R precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for POLR1E (3 products)

Catalog No. Species Pres. Purity   Source  

POLR1E

POLR1E Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

POLR1E

POLR1E Human Purified
  Abnova Taiwan Corp.

POLR1E

POLR1E Human Purified
  Abnova Taiwan Corp.

Positive controls for POLR1E (2 products)

Catalog No. Species Pres. Purity   Source  

POLR1E 293T Cell Transient Overexpression Lysate(Denatured)

POLR1E 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PRAF1 Lysate

PRAF1 Lysate
  Novus Biologicals Inc.
  • LinkedIn