TA344677 MTMR14 / C3orf29 antibody

Rabbit Polyclonal Anti-MTMR14 Antibody - middle region

See related secondary antibodies

Search for all "MTMR14 / C3orf29"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MTMR14 / C3orf29

Product Description for MTMR14 / C3orf29

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat MTMR14 / C3orf29.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MTMR14 / C3orf29

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HCV NS5A-transactivated protein 4 splice variant A-binding protein 1, Myotubularin-related protein 14, NS5ATP4ABP1, hJumpy
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCE2
Immunogen:
The immunogen for anti-MTMR14 antibody: synthetic peptide directed towards the middle region of human MTMR14. Synthetic peptide located within the following region: NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS.
GeneID:
64419
Application WB
Background This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal domint centronuclear myopathy. Alterte splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MTMR14 / C3orf29 (5 products)

Catalog No. Species Pres. Purity   Source  

MTMR14 / C3orf29 (transcript variant 3)

MTMR14 / C3orf29 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MTMR14 / C3orf29 (transcript variant 2)

MTMR14 / C3orf29 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MTMR14 / C3orf29 (transcript variant 1)

MTMR14 / C3orf29 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MTMR14 / C3orf29

MTMR14 / C3orf29 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MTMR14 / C3orf29

MTMR14 / C3orf29 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MTMR14 / C3orf29 (5 products)

Catalog No. Species Pres. Purity   Source  

C3orf29 293T Cell Transient Overexpression Lysate(Denatured)

C3orf29 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MTMR14 Lysate

Western Blot: MTMR14 Lysate [NBL1-13370] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MTMR14
  Novus Biologicals Inc.

MTMR14 Lysate

Western Blot: MTMR14 Lysate [NBL1-13371]
  Novus Biologicals Inc.

MTMR14 overexpression lysate

MTMR14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

MTMR14 overexpression lysate

MTMR14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn