TA344681 RAB17 antibody

Rabbit Polyclonal Anti-RAB17 Antibody - middle region

See related secondary antibodies

Search for all "RAB17"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat RAB17

Product Description for RAB17

Rabbit anti Human, Rat RAB17.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RAB17

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Rab-17, Ras-related protein Rab-17
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0T7
Immunogen:
The immunogen for Anti-Rab17 antibody is: synthetic peptide directed towards the middle region of Rab17. Synthetic peptide located within the following region: HPGEVVVMLVGNKTDLGEEREVTFQEGKEFAESKSLLFMESSAKLNYQVS.
GeneID:
64284
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RAB17 (5 products)

Catalog No. Species Pres. Purity   Source  

RAB17

RAB17 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RAB17 (1-212, His-tag)

RAB17 Human Purified > 90 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

RAB17 (1-212, His-tag)

RAB17 Human Purified > 90 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

RAB17

RAB17 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RAB17

RAB17 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RAB17 (2 products)

Catalog No. Species Pres. Purity   Source  

RAB17 Lysate(Denatured)

RAB17 Lysate(Denatured)
  Abnova Taiwan Corp.

Rab17 Lysate

Western Blot: Rab17 Lysate [NBL1-15043] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RAB17
  Novus Biologicals Inc.
  • LinkedIn