TA344684 Njmu-R1 antibody

Rabbit Polyclonal Anti-C17orf75 Antibody - middle region

See related secondary antibodies

Search for all "Njmu-R1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit Njmu-R1

Product Description for Njmu-R1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit Njmu-R1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Njmu-R1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C17orf75
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HAS0
Immunogen:
The immunogen for anti-C17orf75 antibody: synthetic peptide directed towards the middle region of human C17orf75. Synthetic peptide located within the following region: KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE.
GeneID:
64149
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Njmu-R1 (5 products)

Catalog No. Species Pres. Purity   Source  

Njmu-R1

Njmu-R1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Njmu-R1

Njmu-R1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Njmu-R1

Njmu-R1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Njmu-R1

Njmu-R1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Njmu-R1

Njmu-R1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Njmu-R1 (2 products)

Catalog No. Species Pres. Purity   Source  

C17orf75 293T Cell Transient Overexpression Lysate(Denatured)

C17orf75 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

C17orf75 Lysate

Western Blot: Njmu-R1  Lysate [NBL1-08243] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for Njmu-R1 Protein
  Novus Biologicals Inc.
  • LinkedIn