TA344688 Fructosamine-3-kinase antibody

Rabbit Polyclonal Anti-FN3K Antibody - N-terminal region

See related secondary antibodies

Search for all "Fructosamine-3-kinase"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat Fructosamine-3-kinase

Product Description for Fructosamine-3-kinase

Rabbit anti Human, Rat Fructosamine-3-kinase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Fructosamine-3-kinase

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FN3K
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H479
Immunogen:
The immunogen for Anti-Fn3k antibody is: synthetic peptide directed towards the N-terminal region of Rat Fn3k. Synthetic peptide located within the following region: LQAQLDLIEKDYADRETQELWSRLQVKIPELFSGIEIVPALLHGDLWSGN.
GeneID:
64122
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Fructosamine-3-kinase (7 products)

Catalog No. Species Pres. Purity   Source  

Fructosamine-3-kinase

Fructosamine-3-kinase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Fructosamine-3-kinase (1-309, His-tag)

Fructosamine-3-kinase Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

Fructosamine-3-kinase (1-309, His-tag)

Fructosamine-3-kinase Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

Fructosamine-3-kinase

Fructosamine-3-kinase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Fructosamine-3-kinase

Fructosamine-3-kinase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Fructosamine-3-kinase

Fructosamine-3-kinase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Fructosamine-3-kinase

Fructosamine-3-kinase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Fructosamine-3-kinase (3 products)

Catalog No. Species Pres. Purity   Source  

FN3K 293T Cell Transient Overexpression Lysate(Denatured)

FN3K 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FN3K Lysate

Western Blot: FN3K Lysate [NBL1-10780] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for FN3K.
  Novus Biologicals Inc.

FN3K overexpression lysate

FN3K overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn