TA344689 RRAGC / Rag C antibody

Rabbit Polyclonal Anti-RRAGC Antibody - N-terminal region

See related secondary antibodies

Search for all "RRAGC / Rag C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish RRAGC / Rag C

Product Description for RRAGC / Rag C

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish RRAGC / Rag C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RRAGC / Rag C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GTPase-interacting protein 2, GTR2, RagC, Ras-related GTP-binding protein C, TIB929
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HB90
Immunogen:
The immunogen for anti-RRAGC antibody: synthetic peptide directed towards the N terminal of human RRAGC. Synthetic peptide located within the following region: RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ.
GeneID:
64121
Application WB
Background RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and sigling pathways.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RRAGC / Rag C (5 products)

Catalog No. Species Pres. Purity   Source  

RRAGC / Rag C

RRAGC / Rag C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RRAGC / Rag C (1-399, His-tag)

RRAGC / Rag C Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

RRAGC / Rag C (1-399, His-tag)

RRAGC / Rag C Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

RRAGC / Rag C

RRAGC / Rag C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RRAGC / Rag C

RRAGC / Rag C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RRAGC / Rag C (2 products)

Catalog No. Species Pres. Purity   Source  

RRAGC Lysate

Western Blot: RRAGC Lysate [NBL1-15587] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RRAGC
  Novus Biologicals Inc.

RRAGC overexpression lysate

RRAGC overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn