TA344691 DUS1L antibody

Rabbit Polyclonal Anti-DUS1L Antibody - middle region

See related secondary antibodies

Search for all "DUS1L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat DUS1L

Product Description for DUS1L

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rat DUS1L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DUS1L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms tRNA-dihydrouridine synthase 1-like
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P1R4
Immunogen:
The immunogen for anti-DUS1L antibody: synthetic peptide directed towards the middle region of human DUS1L. Synthetic peptide located within the following region: KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK.
GeneID:
64118
Application WB
Background DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRs.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DUS1L (3 products)

Catalog No. Species Pres. Purity   Source  

DUS1L

DUS1L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DUS1L

DUS1L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DUS1L

DUS1L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for DUS1L (3 products)

Catalog No. Species Pres. Purity   Source  

DUS1L 293T Cell Transient Overexpression Lysate(Denatured)

DUS1L 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

DUS1L Lysate

Western Blot: DUS1L Lysate [NBL1-10042] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DUS1L
  Novus Biologicals Inc.

DUS1L overexpression lysate

DUS1L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn