TA344693 PARVG antibody

Rabbit Polyclonal Anti-PARVG Antibody - N-terminal region

See related secondary antibodies

Search for all "PARVG"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PARVG

Product Description for PARVG

Rabbit anti Human PARVG.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PARVG

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Gamma-parvin, Parvin gamma
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HBI0
Immunogen:
The immunogen for Anti-PARVG antibody is: synthetic peptide directed towards the N-terminal region of Human PARVG. Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA.
GeneID:
64098
Application WB
Background Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PARVG (4 products)

Catalog No. Species Pres. Purity   Source  

PARVG (transcript variant 1)

PARVG Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PARVG (transcript variant 2)

PARVG Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PARVG

PARVG Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PARVG

PARVG Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PARVG (2 products)

Catalog No. Species Pres. Purity   Source  

PARVG 293T Cell Transient Overexpression Lysate(Denatured)

PARVG 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Parvin gamma Lysate

Western Blot: Parvin gamma Lysate [NBL1-14122] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PARVG.
  Novus Biologicals Inc.
  • LinkedIn