TA344694 LHPP antibody

Rabbit Polyclonal Anti-LHPP Antibody - C-terminal region

See related secondary antibodies

Search for all "LHPP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse LHPP

Product Description for LHPP

Rabbit anti Human, Mouse LHPP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LHPP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Phospholysine phosphohistidine inorganic pyrophosphate phosphatase
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H008
Immunogen:
The immunogen for Anti-Lhpp antibody is: synthetic peptide directed towards the C-terminal region of Lhpp. Synthetic peptide located within the following region: VGDVGGAQQCGMRALQVRTGKFRPGDEHHPEVQADGYVDNLAEAVDLLLK.
GeneID:
64077
Application WB
Background Lhpp is a phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. It has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LHPP (2 products)

Catalog No. Species Pres. Purity   Source  

LHPP

LHPP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LHPP

LHPP Human
  Abnova Taiwan Corp.

Positive controls for LHPP (2 products)

Catalog No. Species Pres. Purity   Source  

LHPP overexpression lysate

LHPP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

LHPP overexpression lysate

LHPP overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn