TA344699 FKBPL antibody

Rabbit Polyclonal Anti-FKBPL Antibody - N-terminal region

See related secondary antibodies

Search for all "FKBPL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human FKBPL

Product Description for FKBPL

Rabbit anti Canine, Human FKBPL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FKBPL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DIR1, FK506-binding protein-like, NG7, WAF-1/CIP1 stabilizing protein 39, WISp39
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UIM3
Immunogen:
The immunogen for anti-FKBPL antibody: synthetic peptide directed towards the N terminal of human FKBPL. Synthetic peptide located within the following region: METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE.
GeneID:
63943
Application WB
Background The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FKBPL (7 products)

Catalog No. Species Pres. Purity   Source  

FKBPL

FKBPL Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FKBPL (1-349, His-tag)

FKBPL Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €820.00
  OriGene Technologies GmbH

FKBPL (1-349, His-tag)

FKBPL Human Purified > 90 % by SDS - PAGE E. coli
10 µg / €320.00
  OriGene Technologies GmbH

FKBPL

FKBPL Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FKBPL

FKBPL Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FKBPL

FKBPL Human Purified
  Novus Biologicals Inc.

FKBPL

FKBPL Human Purified
  Novus Biologicals Inc.

Positive controls for FKBPL (2 products)

Catalog No. Species Pres. Purity   Source  

FKBPL 293T Cell Transient Overexpression Lysate(Denatured)

FKBPL 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FKBPL Lysate

Western Blot: FKBPL Lysate [NBL1-10742] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FKBPL
  Novus Biologicals Inc.
  • LinkedIn