TA344701 ANKRD5 antibody

Rabbit Polyclonal Anti-ANKRD5 Antibody - middle region

See related secondary antibodies

Search for all "ANKRD5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ANKRD5

Product Description for ANKRD5

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ANKRD5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ANKRD5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ankyrin repeat domain-containing protein 5
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NU02
Immunogen:
The immunogen for anti-ANKRD5 antibody: synthetic peptide directed towards the middle region of human ANKRD5. Synthetic peptide located within the following region: LDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLK.
GeneID:
63926
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ANKRD5 (2 products)

Catalog No. Species Pres. Purity   Source  

ANKRD5

ANKRD5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ANKRD5

ANKRD5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ANKRD5 (3 products)

Catalog No. Species Pres. Purity   Source  

ANKEF1 overexpression lysate

ANKEF1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ANKEF1 overexpression lysate

ANKEF1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ANKRD5 293T Cell Transient Overexpression Lysate(Denatured)

ANKRD5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn