TA344706 VIPAR antibody

Rabbit Polyclonal Anti-VIPAR Antibody - middle region

See related secondary antibodies

Search for all "VIPAR"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat VIPAR

Product Description for VIPAR

Rabbit anti Bovine, Equine, Human, Mouse, Rabbit, Rat VIPAR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for VIPAR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C14orf133, Protein spe-39 homolog, VPS33B-interacting protein, hSPE-39
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H9C1
Immunogen:
The immunogen for anti-VIPAR antibody: synthetic peptide directed towards the middle region of human VIPAR. Synthetic peptide located within the following region: VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI.
GeneID:
63894
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for VIPAR (2 products)

Catalog No. Species Pres. Purity   Source  

C14orf133 Lysate

Western Blot: VIPAR  Lysate [NBL1-08175] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for VIPAR Protein
  Novus Biologicals Inc.

VIPAS39 overexpression lysate

VIPAS39 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn