TA344709 ABHD4 antibody

Rabbit Polyclonal Anti-ABHD4 Antibody - N-terminal region

See related secondary antibodies

Search for all "ABHD4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat ABHD4

Product Description for ABHD4

Rabbit anti Human, Rat ABHD4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ABHD4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Abhydrolase domain-containing protein 4, Alpha/beta-hydrolase 4, Lyso-N-acylphosphatidylethanolamine lipase
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TB40
Immunogen:
The immunogen for Anti-Abhd4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Abhd4. Synthetic peptide located within the following region: DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRD.
GeneID:
63874
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ABHD4 (2 products)

Catalog No. Species Pres. Purity   Source  

ABHD4

ABHD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ABHD4

ABHD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ABHD4 (2 products)

Catalog No. Species Pres. Purity   Source  

ABHD4 Lysate

Western Blot: ABHD4 Lysate [NBL1-07198] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ABHD4 Protein
  Novus Biologicals Inc.

ABHD4 overexpression lysate

ABHD4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn