TA344714 Serine racemase / SRR antibody

Rabbit Polyclonal Anti-SRR Antibody - middle region

See related secondary antibodies

Search for all "Serine racemase / SRR"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat Serine racemase / SRR

Product Description for Serine racemase / SRR

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat Serine racemase / SRR.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Serine racemase / SRR

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZT4
Immunogen:
The immunogen for anti-SRR antibody: synthetic peptide directed towards the middle region of human SRR. Synthetic peptide located within the following region: GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ.
GeneID:
63826
Application WB
Background SRR catalyzes the synthesis of D-serine from L-serine.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Serine racemase / SRR (6 products)

Catalog No. Species Pres. Purity   Source  

Serine racemase / SRR

Serine racemase / SRR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Serine racemase / SRR (1-340, His-tag)

Serine racemase / SRR Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €820.00
  OriGene Technologies GmbH

Serine racemase / SRR (1-340, His-tag)

Serine racemase / SRR Human Purified > 85 % by SDS - PAGE E. coli
10 µg / €320.00
  OriGene Technologies GmbH

Serine racemase / SRR

Serine racemase / SRR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Serine racemase / SRR

Serine racemase / SRR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Serine racemase / SRR

Serine racemase / SRR Human
  Abnova Taiwan Corp.

Positive controls for Serine racemase / SRR (2 products)

Catalog No. Species Pres. Purity   Source  

Serine racemase Lysate

Western Blot: Serine racemase Lysate [NBL1-16460] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SRR
  Novus Biologicals Inc.

SRR 293T Cell Transient Overexpression Lysate(Denatured)

SRR 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn