TA344718 Brain link protein 1 / BRAL1 antibody

Rabbit Polyclonal Anti-HAPLN2 Antibody - middle region

See related secondary antibodies

Search for all "Brain link protein 1 / BRAL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish Brain link protein 1 / BRAL1

Product Description for Brain link protein 1 / BRAL1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Zebrafish Brain link protein 1 / BRAL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Brain link protein 1 / BRAL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HAPLN2, Hyaluronan and proteoglycan link protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZV7
Immunogen:
The immunogen for anti-HAPLN2 antibody: synthetic peptide directed towards the middle region of human HAPLN2. Synthetic peptide located within the following region: LDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYC.
GeneID:
60484
Application WB
Background HAPLN2 mediates a firm binding of versican V2 to hyaluronic acid.HAPLN2 may play a pivotal role in the formation of the hyaluron-associated matrix in the central nervous system (CNS) which facilitates neurol conduction and general structural stabilization. HAPLN2 binds to hyaluronic acid.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Brain link protein 1 / BRAL1 (2 products)

Catalog No. Species Pres. Purity   Source  

Brain link protein 1 / BRAL1

Brain link protein 1 / BRAL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Brain link protein 1 / BRAL1

Brain link protein 1 / BRAL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn