TA344719 MMP-26 antibody

Rabbit Polyclonal Anti-MMP26 Antibody - C-terminal region

See related secondary antibodies

Search for all "MMP-26"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MMP-26

Product Description for MMP-26

Rabbit anti Human MMP-26.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MMP-26

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Endometase, MMP26, Matrilysin-2, Matrix metalloproteinase-26
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRE1
Immunogen:
The immunogen for anti-MMP26 antibody: synthetic peptide directed towards the C terminal of human MMP26. Synthetic peptide located within the following region: NLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQH.
GeneID:
56547
Application WB
Background Proteins of the matrix metalloproteise (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as ictive proproteins which are activated when cleaved by extracellular proteises. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-termil protein domain.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MMP-26 (2 products)

Catalog No. Species Pres. Purity   Source  

MMP-26

MMP-26 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MMP-26

MMP-26 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MMP-26 (2 products)

Catalog No. Species Pres. Purity   Source  

MMP26 Lysate

Western Blot: MMP26 Lysate [NBL1-13158] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MMP26
  Novus Biologicals Inc.

MMP26 overexpression lysate

MMP26 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn