TA344721 DNAJC12 / JDP1 antibody

Rabbit Polyclonal Anti-DNAJC12 Antibody - middle region

See related secondary antibodies

Search for all "DNAJC12 / JDP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse DNAJC12 / JDP1

Product Description for DNAJC12 / JDP1

Rabbit anti Human, Mouse DNAJC12 / JDP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DNAJC12 / JDP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DnaJ homolog subfamily C member 12, J domain-containing protein 1
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UKB3
Immunogen:
The immunogen for Anti-Dnajc12 antibody is synthetic peptide directed towards the middle region of Mouse Dnajc12. Synthetic peptide located within the following region: LAEFKIRALECHPDKHPENSKAVETFQKLQKAKEILCNAESRARYDHWRR.
GeneID:
56521
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJC12 / JDP1 (6 products)

Catalog No. Species Pres. Purity   Source  

DNAJC12 / JDP1 (transcript variant 1)

DNAJC12 / JDP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DNAJC12 / JDP1 (transcript variant 2)

DNAJC12 / JDP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DNAJC12 / JDP1 (1-198, His-tag)

DNAJC12 / JDP1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

DNAJC12 / JDP1 (1-198, His-tag)

DNAJC12 / JDP1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

DNAJC12 / JDP1

DNAJC12 / JDP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DNAJC12 / JDP1

DNAJC12 / JDP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DNAJC12 / JDP1 (1 products)

Catalog No. Species Pres. Purity   Source  

DNAJC12 overexpression lysate

DNAJC12 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn