TA344722 Transducin beta chain 4 (GNB4) antibody

Rabbit Polyclonal Anti-GNB4 Antibody - middle region

See related secondary antibodies

Search for all "Transducin beta chain 4 (GNB4)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Mouse, Rabbit, Rat Transducin beta chain 4 (GNB4)

TA344722

More Views

  • TA344722

Product Description for Transducin beta chain 4 (GNB4)

Rabbit anti Bovine, Canine, Equine, Mouse, Rabbit, Rat Transducin beta chain 4 (GNB4).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Transducin beta chain 4 (GNB4)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Guanine nucleotide-binding protein subunit beta-4
Presentation Purified
Reactivity Bov, Can, Eq, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HAV0
Immunogen:
The immunogen for anti-GNB4 antibody: synthetic peptide directed towards the middle region of human GNB4. Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY.
GeneID:
59345
Application WB
Background Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate sigls between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain sigl transduction receptors and effectors.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Transducin beta chain 4 (GNB4) (4 products)

Catalog No. Species Pres. Purity   Source  

Transducin beta chain 4 (GNB4)

Transducin beta chain 4 (GNB4) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Transducin beta chain 4 (GNB4)

Transducin beta chain 4 (GNB4) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Transducin beta chain 4 (GNB4)

Transducin beta chain 4 (GNB4) Human Purified 95 % E. coli
  GenWay Biotech Inc.

Transducin beta chain 4 (GNB4)

Transducin beta chain 4 (GNB4) Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for Transducin beta chain 4 (GNB4) (2 products)

Catalog No. Species Pres. Purity   Source  

GNB4 overexpression lysate

GNB4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

G protein beta 4 Lysate

Western Blot: G protein beta 4 Lysate [NBL1-11168] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GNB4
  Novus Biologicals Inc.
  • LinkedIn