TA344727 RPRD1B antibody

Rabbit Polyclonal Anti-RPRD1B Antibody - C-terminal region

See related secondary antibodies

Search for all "RPRD1B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse RPRD1B

Product Description for RPRD1B

Rabbit anti Human, Mouse RPRD1B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPRD1B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf77, CREPT, Cell cycle-related and expression-elevated protein in tumor, Regulation of nuclear pre-mRNA domain-containing protein 1B, chromosome 20 open reading frame 77
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQG5
Immunogen:
The immunogen for Anti-Rprd1b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rprd1b. Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY.
GeneID:
58490
Application WB
Background Rprd1b interacts with phosphorylated C-termil heptapeptide repeat domain (CTD) of the largest R polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. It is a transcriptiol regulator which enhances expression of CCND1. It promotes binding of R polymerase II to the CCDN1 promoter and to the termition region before the poly-A site but decreases its binding after the poly-A site. It prevents R polymerase II from reading through the 3' end termition site and may allow it to be recruited back to the promoter through promotion of the formation of a chromatin loop. It also enhances the transcription of a number of other cell cycle-related genes including CDK2, CDK4, CDK6 and cyclin-E but not CDKN1A, CDKN1B or cyclin-A. Rprd1b promotes cell proliferation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPRD1B (5 products)

Catalog No. Species Pres. Purity   Source  

RPRD1B

RPRD1B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RPRD1B (1-326, His-tag)

RPRD1B Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

RPRD1B (1-326, His-tag)

RPRD1B Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

RPRD1B

RPRD1B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RPRD1B

RPRD1B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPRD1B (1 products)

Catalog No. Species Pres. Purity   Source  

RPRD1B Lysate

Western Blot: RPRD1B Lysate [NBL1-08380] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RPRD1B Protein
  Novus Biologicals Inc.
  • LinkedIn