TA344728 TRAPPC1 antibody

Rabbit Polyclonal Anti-TRAPPC1 Antibody - middle region

See related secondary antibodies

Search for all "TRAPPC1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Mouse, Rat, Zebrafish TRAPPC1

Product Description for TRAPPC1

Rabbit anti Canine, Mouse, Rat, Zebrafish TRAPPC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRAPPC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BET5, MUM-2, MUM2, Multiple myeloma protein 2, Trafficking protein particle complex subunit 1
Presentation Purified
Reactivity Can, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5R8
Immunogen:
The immunogen for anti-TRAPPC1 antibody: synthetic peptide directed towards the middle region of human TRAPPC1. Synthetic peptide located within the following region: YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM.
GeneID:
58485
Application WB
Background This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Altertive splicing results in multiple transcript variants.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRAPPC1 (3 products)

Catalog No. Species Pres. Purity   Source  

TRAPPC1

TRAPPC1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRAPPC1

TRAPPC1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TRAPPC1

TRAPPC1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TRAPPC1 (4 products)

Catalog No. Species Pres. Purity   Source  

TRAPPC1 293T Cell Transient Overexpression Lysate(Denatured)

TRAPPC1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRAPPC1 Lysate

Western Blot: TRAPPC1 Lysate [NBL1-17256] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRAPPC1
  Novus Biologicals Inc.

TRAPPC1 overexpression lysate

TRAPPC1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TRAPPC1 overexpression lysate

TRAPPC1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn