TA344736 TRIB3 antibody

Rabbit Polyclonal Anti-TRIB3 Antibody - N-terminal region

See related secondary antibodies

Search for all "TRIB3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TRIB3

Product Description for TRIB3

Rabbit anti Human TRIB3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIB3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NIPK, SKIP3, TRB-3, TRB3, Tribbles homolog 3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96RU7
Immunogen:
The immunogen for Anti-TRIB3 antibody is: synthetic peptide directed towards the N-terminal region of Human TRIB3. Synthetic peptide located within the following region: KNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPV.
GeneID:
57761
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIB3 (8 products)

Catalog No. Species Pres. Purity   Source  

TRIB3 (1-358, His-tag)

TRIB3 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

TRIB3 (1-358, His-tag)

TRIB3 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

TRIB3

TRIB3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIB3

TRIB3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIB3

TRIB3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIB3

TRIB3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIB3

TRIB3 Human
  Abnova Taiwan Corp.

TRIB3

TRIB3 Human
  Abnova Taiwan Corp.

Positive controls for TRIB3 (3 products)

Catalog No. Species Pres. Purity   Source  

TRIB3 293T Cell Transient Overexpression Lysate(Denatured)

TRIB3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRIB3 Lysate

Western Blot: TRIB3 Lysate [NBL1-17273] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRIB3
  Novus Biologicals Inc.

TRIB3 overexpression lysate

TRIB3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn