TA344740 Scramblase 1 / PLSCR1 antibody

Rabbit Polyclonal Anti-PLSCR1 Antibody

See related secondary antibodies

Search for all "Scramblase 1 / PLSCR1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Scramblase 1 / PLSCR1

TA344740

More Views

  • TA344740
  • TA344740

Product Description for Scramblase 1 / PLSCR1

Rabbit anti Human Scramblase 1 / PLSCR1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Scramblase 1 / PLSCR1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ca(2+)-dependent phospholipid scramblase 1, Erythrocyte phospholipid scramblase, MmTRA1b, PL scramblase 1, Phospholipid scramblase 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15162
Immunogen:
The immunogen for anti-PLSCR1 antibody: synthetic peptide directed towards the N terminal of human PLSCR1. Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP.
GeneID:
5359
Application WB
Background PLSCR1 may mediate accelerated ATP-independent bidirectiol transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Scramblase 1 / PLSCR1 (7 products)

Catalog No. Species Pres. Purity   Source  

Scramblase 1 / PLSCR1 (1-288, His-tag)

Scramblase 1 / PLSCR1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

Scramblase 1 / PLSCR1 (1-288, His-tag)

Scramblase 1 / PLSCR1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

Scramblase 1 / PLSCR1

Scramblase 1 / PLSCR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Scramblase 1 / PLSCR1

Scramblase 1 / PLSCR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Scramblase 1 / PLSCR1

Scramblase 1 / PLSCR1 Human Purified
  Abnova Taiwan Corp.

Scramblase 1 / PLSCR1

Scramblase 1 / PLSCR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Scramblase 1 / PLSCR1

Scramblase 1 / PLSCR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Scramblase 1 / PLSCR1 (2 products)

Catalog No. Species Pres. Purity   Source  

PLSCR1 293T Cell Transient Overexpression Lysate(Denatured)

PLSCR1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Scramblase 1 Lysate

Western Blot: Scramblase 1 Lysate [NBL1-14525] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PLSCR1.
  Novus Biologicals Inc.
  • LinkedIn