TA344741 NDUFV2 antibody

Rabbit Polyclonal Anti-NDUFV2 Antibody

See related secondary antibodies

Search for all "NDUFV2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human NDUFV2

Product Description for NDUFV2

Rabbit anti Canine, Equine, Guinea Pig, Human NDUFV2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NDUFV2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NADH dehydrogenase [ubiquinone] flavoprotein 2, NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial
Presentation Purified
Reactivity Can, Eq, GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P19404
Immunogen:
The immunogen for anti-Ndufv2 antibody: synthetic peptide directed towards the C terminal of human Ndufv2. Synthetic peptide located within the following region: DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK.
GeneID:
4729
Application WB
Background Core subunit of the mitochondrial membrane respiratory chain DH dehydrogese (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from DH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NDUFV2 (7 products)

Catalog No. Species Pres. Purity   Source  

NDUFV2

NDUFV2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NDUFV2 (33-249, His-tag)

NDUFV2 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

NDUFV2 (33-249, His-tag)

NDUFV2 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

NDUFV2

NDUFV2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NDUFV2

NDUFV2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NDUFV2

NDUFV2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NDUFV2

NDUFV2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NDUFV2 (2 products)

Catalog No. Species Pres. Purity   Source  

NDUFV2 293T Cell Transient Overexpression Lysate(Denatured)

NDUFV2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NDUFV2 Lysate

Western Blot: NDUFV2 Lysate [NBL1-13567] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NDUFV2
  Novus Biologicals Inc.
  • LinkedIn