TA344744 Bcl-7A antibody

Rabbit Polyclonal Anti-BCL7A Antibody

See related secondary antibodies

Search for all "Bcl-7A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Zebrafish Bcl-7A

TA344744

More Views

  • TA344744
  • TA344744

Product Description for Bcl-7A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Zebrafish Bcl-7A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Bcl-7A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms B-cell CLL/lymphoma 7 protein family member A, BCL7A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4VC05
Immunogen:
The immunogen for anti-BCL7A antibody: synthetic peptide directed towards the middle region of human BCL7A. Synthetic peptide located within the following region: CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN.
GeneID:
605
Application WB
Background This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-termil region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-termil segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Bcl-7A (7 products)

Catalog No. Species Pres. Purity   Source  

Bcl-7A (transcript variant 2)

Bcl-7A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Bcl-7A (1-210, His-tag)

Bcl-7A Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €820.00
  OriGene Technologies GmbH

Bcl-7A (1-210, His-tag)

Bcl-7A Human Purified > 85 % by SDS - PAGE E. coli
20 µg / €320.00
  OriGene Technologies GmbH

Bcl-7A

Bcl-7A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Bcl-7A

Bcl-7A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Bcl-7A

Bcl-7A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Bcl-7A

Bcl-7A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Bcl-7A (1 products)

Catalog No. Species Pres. Purity   Source  

BCL7A overexpression lysate

BCL7A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn