TA344746 KIAA1609 antibody

Rabbit Polyclonal Anti-KIAA1609 Antibody

See related secondary antibodies

Search for all "KIAA1609"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human KIAA1609

Product Description for KIAA1609

Rabbit anti Human KIAA1609.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA1609

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TLD domain-containing protein KIAA1609
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P9B6
Immunogen:
The immunogen for anti-KIAA1609 antibody: synthetic peptide directed towards the N terminal of human KIAA1609. Synthetic peptide located within the following region: MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKAL.
GeneID:
57707
Application WB
Background The function of KIAA1609 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIAA1609 (2 products)

Catalog No. Species Pres. Purity   Source  

KIAA1609

KIAA1609 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KIAA1609

KIAA1609 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KIAA1609 (1 products)

Catalog No. Species Pres. Purity   Source  

KIAA1609 Lysate

Western Blot: KIAA1609 Lysate [NBL1-12272] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KIAA1609
  Novus Biologicals Inc.
  • LinkedIn