TA344748 FAM160B1 antibody

Rabbit Polyclonal Anti-FAM160B1 Antibody

See related secondary antibodies

Search for all "FAM160B1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Rabbit, Rat, Zebrafish FAM160B1

Product Description for FAM160B1

Rabbit anti Canine, Equine, Guinea Pig, Human, Rabbit, Rat, Zebrafish FAM160B1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM160B1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1600, UPF0518 protein FAM160B1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5W0V3
Immunogen:
The immunogen for anti-FAM160B1 antibody: synthetic peptide directed towards the N terminal of human FAM160B1. Synthetic peptide located within the following region: HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH.
GeneID:
57700
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM160B1 (3 products)

Catalog No. Species Pres. Purity   Source  

FAM160B1 (transcript variant 1)

FAM160B1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FAM160B1

FAM160B1 Human Purified
  Abnova Taiwan Corp.

FAM160B1

FAM160B1 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn