TA344751 MAGE-D4 antibody

Rabbit Polyclonal Anti-MAGED4B Antibody

See related secondary antibodies

Search for all "MAGE-D4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Mouse, Rat MAGE-D4

Product Description for MAGE-D4

Rabbit anti Guinea Pig, Human, Mouse, Rat MAGE-D4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MAGE-D4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MAGED4, MAGED4A, MAGEE1, Melanoma-associated antigen D4
Presentation Purified
Reactivity GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96JG8
Immunogen:
The immunogen for anti-Magee1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE.
GeneID:
728239
Application WB
Background The function remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MAGE-D4 (2 products)

Catalog No. Species Pres. Purity   Source  

MAGE-D4

MAGE-D4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MAGE-D4

MAGE-D4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for MAGE-D4 (1 products)

Catalog No. Species Pres. Purity   Source  

MAGED4B Lysate

Western Blot: MAGED4B Lysate [NBL1-12817] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MAGED4B
  Novus Biologicals Inc.
  • LinkedIn