TA344755 CCDC146 antibody

Rabbit Polyclonal Anti-CCDC146 Antibody

See related secondary antibodies

Search for all "CCDC146"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine CCDC146

Product Description for CCDC146

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine CCDC146.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CCDC146

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Coiled-coil domain-containing protein 146, KIAA1505
Presentation Purified
Reactivity Bov, Can, GP, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IYE0
Immunogen:
The immunogen for anti-CCDC146 antibody: synthetic peptide directed towards the middle region of human CCDC146. Synthetic peptide located within the following region: KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA.
GeneID:
57639
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CCDC146 (2 products)

Catalog No. Species Pres. Purity   Source  

CCDC146

CCDC146 Human Purified
  Abnova Taiwan Corp.

CCDC146

CCDC146 Human Purified
  Abnova Taiwan Corp.

Positive controls for CCDC146 (1 products)

Catalog No. Species Pres. Purity   Source  

CCDC146 Lysate

Western Blot: CCDC146 Lysate [NBL1-08782] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CCDC146
  Novus Biologicals Inc.
  • LinkedIn