TA344758 KIF17 antibody

Rabbit Polyclonal Anti-KIF17 Antibody

See related secondary antibodies

Search for all "KIF17"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse KIF17

Product Description for KIF17

Rabbit anti Human, Mouse KIF17.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIF17

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1405, KIF17, KIF3-related motor protein, KIF3X, Kinesin-like protein KIF17
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P2E2
Immunogen:
The immunogen for Anti-Kif17 antibody is: synthetic peptide directed towards the middle region of Mouse Kif17. Synthetic peptide located within the following region: TGWKNRAVGYTLMNKDSSRSHSIFTINIEIYAVDERGKDHLRAGKLNLVD.
GeneID:
57576
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIF17 (2 products)

Catalog No. Species Pres. Purity   Source  

KIF17

KIF17 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KIF17

KIF17 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KIF17 (2 products)

Catalog No. Species Pres. Purity   Source  

KIF17 Lysate

Western Blot: KIF17 Lysate [NBL1-12287] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KIF17
  Novus Biologicals Inc.

KIF17 overexpression lysate

KIF17 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn