TA344765 KCTD16 antibody

Rabbit Polyclonal Anti-KCTD16 Antibody

See related secondary antibodies

Search for all "KCTD16"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat, Zebrafish KCTD16

Product Description for KCTD16

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat, Zebrafish KCTD16.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCTD16

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB/POZ domain-containing protein KCTD16, KCTD16, KIAA1317
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68DU8
Immunogen:
The immunogen for anti-KCTD16 antibody: synthetic peptide directed towards the N terminal of human KCTD16. Synthetic peptide located within the following region: KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL.
GeneID:
57528
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCTD16 (1 products)

Catalog No. Species Pres. Purity   Source  

KCTD16

KCTD16 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for KCTD16 (1 products)

Catalog No. Species Pres. Purity   Source  

KCTD16 Lysate

Western Blot: KCTD16 Lysate [NBL1-12213] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KCTD16
  Novus Biologicals Inc.
  • LinkedIn