TA344767 ARHGAP13 / SRGAP1 antibody

Rabbit Polyclonal Anti-SRGAP1 Antibody

See related secondary antibodies

Search for all "ARHGAP13 / SRGAP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ARHGAP13 / SRGAP1

Product Description for ARHGAP13 / SRGAP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ARHGAP13 / SRGAP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARHGAP13 / SRGAP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1304, Rho GTPase-activating protein 13, SLIT-ROBO Rho GTPase-activating protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z6B7
Immunogen:
The immunogen for anti-Srgap1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG.
GeneID:
57522
Application WB
Background The function remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ARHGAP13 / SRGAP1 (3 products)

Catalog No. Species Pres. Purity   Source  

ARHGAP13 / SRGAP1

ARHGAP13 / SRGAP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

ARHGAP13 / SRGAP1

ARHGAP13 / SRGAP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ARHGAP13 / SRGAP1

ARHGAP13 / SRGAP1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ARHGAP13 / SRGAP1 (2 products)

Catalog No. Species Pres. Purity   Source  

SRGAP1 293T Cell Transient Overexpression Lysate(Denatured)

SRGAP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SRGAP1 overexpression lysate

SRGAP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn