TA344768 COG6 antibody

Rabbit Polyclonal Anti-COG6 Antibody - C-terminal region

See related secondary antibodies

Search for all "COG6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human COG6

Product Description for COG6

Rabbit anti Human COG6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for COG6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms COG complex subunit 6, Component of oligomeric Golgi complex 6, Conserved oligomeric Golgi complex subunit 6, KIAA1134
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2V7
Immunogen:
The immunogen for Anti-COG6 antibody is: synthetic peptide directed towards the C-terminal region of Human COG6. Synthetic peptide located within the following region: ADMATFMVNSLYMMKTTLALFEFTDRRLEMLQFQIEAHLDTLINEQASYV.
GeneID:
57511
Application WB
Background This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi apparatus. The encoded protein is organized with conserved oligomeric Golgi complex components 5, 7 and 8 into a sub-complex referred to as lobe B. Altertive splicing results in multiple transcript variants.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for COG6 (3 products)

Catalog No. Species Pres. Purity   Source  

COG6 (transcript variant 1)

COG6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

COG6

COG6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

COG6

COG6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for COG6 (1 products)

Catalog No. Species Pres. Purity   Source  

COG6 Lysate

Western Blot: COG6 Lysate [NBL1-09345] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for COG6
  Novus Biologicals Inc.
  • LinkedIn