TA344780 ASPHD2 antibody

Rabbit Polyclonal Anti-ASPHD2 Antibody - middle region

See related secondary antibodies

Search for all "ASPHD2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ASPHD2

Product Description for ASPHD2

Rabbit anti Human ASPHD2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ASPHD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Aspartate beta-hydroxylase domain-containing protein 2
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ICH7
Immunogen:
Synthetic peptide directed towards the middle region of human ASPHD2
AA Sequence:
YCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYL
GeneID:
57168
Application Western blotting (0.2 - 1 µg/ml)
Background Aspartate beta-hydroxylase domain-containing protein 2 is a single-pass type II membrane protein of 41 kDa. It belongs to the aspartyl/asparaginyl beta-hydroxylase family. The functions is so far unknown.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Bovine, Chicken, Dog, Pig, Guinea Pig, Rabbit, Horse
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ASPHD2 (3 products)

Catalog No. Species Pres. Purity   Source  

ASPHD2

ASPHD2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ASPHD2

ASPHD2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ASPHD2

ASPHD2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn