TA344784 CAMK1D antibody

Rabbit Polyclonal Anti-CAMK1D Antibody - middle region

See related secondary antibodies

Search for all "CAMK1D"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit CAMK1D

Product Description for CAMK1D

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit CAMK1D.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CAMK1D

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CKLiK, CaM kinase I delta, CaM kinase ID, CaMKI-delta, Calcium/calmodulin-dependent protein kinase type 1D, CamKI-like protein kinase, Camk1D
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IU85
Immunogen:
The immunogen for anti-CAMK1D antibody: synthetic peptide directed towards the middle region of human CAMK1D. Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS.
GeneID:
57118
Application WB
Background This gene encodes a member of the Ca2+/calmodulin-dependent protein kise 1 subfamily of serine/threonine kises. The encoded protein may be involved in the regulation of granulocyte function through the chemokine sigl transduction pathway. Altertively spliced transcript variants encoding different isoforms of this gene have been described.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CAMK1D (7 products)

Catalog No. Species Pres. Purity   Source  

CAMK1D (transcript variant 2)

CAMK1D Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CAMK1D

CAMK1D Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CAMK1D

CAMK1D Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CAMK1D

CAMK1D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CAMK1D

CAMK1D Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CAMK1D

CAMK1D Human
  Abnova Taiwan Corp.

CAMK1D

CAMK1D Human
  Abnova Taiwan Corp.

Positive controls for CAMK1D (2 products)

Catalog No. Species Pres. Purity   Source  

CAMK1D 293T Cell Transient Overexpression Lysate(Denatured)

CAMK1D 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CAMK1D Lysate

Western Blot: CAMK1D Lysate [NBL1-08659] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CAMK1D.
  Novus Biologicals Inc.
  • LinkedIn